The domain within your query sequence starts at position 563 and ends at position 621; the E-value for the RNA_pol_Rpa2_4 domain shown below is 4.1e-23.
VGWVDKDLAPEVADTLRRFKVLREKRIPPWMEVALIPMTGKPSLYPGLFLFTTPCRLVR
RNA_pol_Rpa2_4 |
 |
|---|
| PFAM accession number: | PF06883 |
|---|---|
| Interpro abstract (IPR009674): | This domain is found between domain 3 and domain 5, but shows no homology to domain 4 of Rpb2. The external domains in multisubunit RNA polymerase (those most distant from the active site) are known to demonstrate more sequence variability [ (PUBMED:11313498) ]. |
| GO process: | transcription, DNA-templated (GO:0006351) |
| GO component: | nucleus (GO:0005634) |
| GO function: | DNA-directed 5'-3' RNA polymerase activity (GO:0003899) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNA_pol_Rpa2_4