The domain within your query sequence starts at position 567 and ends at position 629; the E-value for the RNA_pol_Rpb2_4 domain shown below is 7.4e-27.
IFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLL IVE
RNA_pol_Rpb2_4 |
 |
|---|
| PFAM accession number: | PF04566 |
|---|---|
| Interpro abstract (IPR007646): | RNA polymerases catalyse the DNA dependent polymerisation of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial and chloroplast polymerases). Domain 4 is also known as the external 2 domain [ (PUBMED:11313498) ]. |
| GO process: | transcription, DNA-templated (GO:0006351) |
| GO function: | DNA-directed 5'-3' RNA polymerase activity (GO:0003899), DNA binding (GO:0003677) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNA_pol_Rpb2_4