The domain within your query sequence starts at position 137 and ends at position 209; the E-value for the RNA_pol_Rpb5_C domain shown below is 6.7e-38.
INITEHELVPEHVVMTKEEVTELLARYKLRESQLPRIQAGDPVARYFGIKRGQVVKIIRP SETAGRYITYRLV
RNA_pol_Rpb5_C |
 |
|---|
| PFAM accession number: | PF01191 |
|---|---|
| Interpro abstract (IPR000783): | This entry represents prokaryotic subunit H and the C-terminal domain of eukaryotic RPB5, which share a two-layer alpha/beta fold, with a core structure of beta/alpha/beta/alpha/beta(2). Prokaryotes contain a single DNA-dependent RNA polymerase (RNAP; EC 2.7.7.6 ) that is responsible for the transcription of all genes, while eukaryotes have three classes of RNAPs (I-III) that transcribe different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. Certain subunits of RNAPs, including RPB5 (POLR2E in mammals), are common to all three eukaryotic polymerases. RPB5 plays a role in the transcription activation process. Eukaryotic RPB5 has a bipartite structure consisting of a unique N-terminal region ( IPR005571 ), plus a C-terminal region that is structurally homologous to the prokaryotic RPB5 homologue, subunit H (gene rpoH) [ (PUBMED:10841538) (PUBMED:10191143) (PUBMED:1729711) (PUBMED:10841537) ]. |
| GO process: | transcription, DNA-templated (GO:0006351) |
| GO function: | DNA-directed 5'-3' RNA polymerase activity (GO:0003899), DNA binding (GO:0003677) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNA_pol_Rpb5_C