The domain within your query sequence starts at position 262 and ends at position 389; the E-value for the RNA_pol_Rpc4 domain shown below is 3e-36.
KDEELLFLQLPDTLPGQPPTQDIKPVKTEVQGEDGQMVVIKQEKDREARLAENACTLADL TEGQVGKLLIRKSGKVQLLLGKVTLDVTMGTTCSFLQELVSVGLGDSRTGEMTVLGHVKH KLVCSPDF
RNA_pol_Rpc4 |
---|
PFAM accession number: | PF05132 |
---|---|
Interpro abstract (IPR007811): | This entry represents a component of the RNA polymerase III (Pol III) complex which catalyse the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates [ (PUBMED:19631370) ]. |
GO process: | transcription by RNA polymerase III (GO:0006383) |
GO component: | RNA polymerase III complex (GO:0005666) |
GO function: | DNA binding (GO:0003677) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNA_pol_Rpc4