The domain within your query sequence starts at position 1 and ends at position 87; the E-value for the RNase_H2_suC domain shown below is 5.8e-15.

XVAVPPGFAGFVMVTEEKGEGLIGKLNFSGDAEDKADEAQEPLERDFDRLIGATGSFSHF
TLWGLETVPGPDAKVHRALGWPSLAAA

RNase_H2_suC

RNase_H2_suC
PFAM accession number:PF08615
Interpro abstract (IPR013924):

Whereas bacterial and archaeal RNases H2 are active as single polypeptides, eukaryotic RNase H2 is a heterotrimeric complex of the RNase H2A, RNase H2B, and RNase H2C proteins that are all required for proper function and activity (PUBMED:14734815) (PUBMED:19923215) ]. RNase H2 is an endonuclease that specifically degrades the RNA of RNA:DNA hybrids. It participates in DNA replication, possibly by mediating the removal of lagging-strand Okazaki fragment RNA primers during DNA replication.

This entry represents the non-catalytic C subunit of RNase H2.

GO process:RNA catabolic process (GO:0006401)
GO component:ribonuclease H2 complex (GO:0032299)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNase_H2_suC