The domain within your query sequence starts at position 7 and ends at position 117; the E-value for the RNase_P_Rpp14 domain shown below is 3.7e-31.
RYLLCELVSEDARCRLSLDDRVLGGLVRDTIARVHGAFGAAACSVGFAVRYLNAYTGVVL LRCRKDFYQLVWSALPFITYLENKGHRYPCFFNTLHVGGTIRTCQKFLIQY
RNase_P_Rpp14 |
---|
PFAM accession number: | PF01900 |
---|---|
Interpro abstract (IPR002759): | This family contains proteins found in some eukaryotes and archaebacteria that are related to yeast ribonuclease P. This enzyme is essential for tRNA processing generating 5'-termini of mature tRNA molecules [ (PUBMED:7731988) ]. tRNA processing enzyme ribonuclease P (RNase P) consists of an RNA molecule associated with at least eight protein subunits, hPop1, Rpp14, Rpp20, Rpp25, Rpp29, Rpp30, Rpp38, and Rpp40 [ (PUBMED:10024167) ]. |
GO process: | tRNA processing (GO:0008033) |
GO function: | ribonuclease activity (GO:0004540) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNase_P_Rpp14