SMART: Pfam domain RNase

The domain within your query sequence starts at position 72 and ends at position 138; the E-value for the RNase_T domain shown below is 1.9e-15.

VAIDCEMVGTGPQGRVSELARCSVVSYSGDVLYDKYIRPEMPIVDYRTRWSGITRQHMHK
AIPFQVA

RNase_T

PFAM accession number:	PF00929
Interpro abstract (IPR013520):	This entry includes a variety of exonuclease proteins, such as ribonuclease T [ (PUBMED:8506149) ] and the epsilon subunit of DNA polymerase III. Ribonuclease T is responsible for the end-turnover of tRNA,and removes the terminal AMP residue from uncharged tRNA. DNA polymerase III is a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria, and also exhibits 3' to 5' exonuclease activity.

PFAM accession number:

PF00929

Interpro abstract (IPR013520):

This entry includes a variety of exonuclease proteins, such as ribonuclease T [ (PUBMED:8506149) ] and the epsilon subunit of DNA polymerase III. Ribonuclease T is responsible for the end-turnover of tRNA,and removes the terminal AMP residue from uncharged tRNA. DNA polymerase III is a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria, and also exhibits 3' to 5' exonuclease activity.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNase_T