The domain within your query sequence starts at position 72 and ends at position 138; the E-value for the RNase_T domain shown below is 1.9e-15.
VAIDCEMVGTGPQGRVSELARCSVVSYSGDVLYDKYIRPEMPIVDYRTRWSGITRQHMHK AIPFQVA
RNase_T |
![]() |
---|
PFAM accession number: | PF00929 |
---|---|
Interpro abstract (IPR013520): | This entry includes a variety of exonuclease proteins, such as ribonuclease T [ (PUBMED:8506149) ] and the epsilon subunit of DNA polymerase III. Ribonuclease T is responsible for the end-turnover of tRNA,and removes the terminal AMP residue from uncharged tRNA. DNA polymerase III is a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria, and also exhibits 3' to 5' exonuclease activity. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNase_T