The domain within your query sequence starts at position 264 and ends at position 420; the E-value for the RNase_Zc3h12a domain shown below is 1.6e-67.
NLRPVVIDGSNVAMSHGNKEVFSCRGIKLAVDWFLERGHKDITVFVPAWRKEQSRPDALI TDQEILRKLEKEKILVFTPSRRVQGRRVVCYDDRFIVKLAFESDGIIVSNDNYRDLANEK PEWKKFIDERLLMYSFVNDKFMPPDDPLGRHGPSLDN
RNase_Zc3h12a |
---|
PFAM accession number: | PF11977 |
---|---|
Interpro abstract (IPR021869): | This domain is found in the Zc3h12a protein which has shown to be a ribonuclease that controls the stability of a set of inflammatory genes [ (PUBMED:19322177) ]. It has been suggested that this domain belongs to the PIN domain superfamily [ (PUBMED:19322177) ]. This domain has also been identified as part of the NYN domain family [ (PUBMED:17114934) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNase_Zc3h12a