The domain within your query sequence starts at position 370 and ends at position 440; the E-value for the RPAP1_C domain shown below is 1.2e-27.

RMQARFSLQGELLAPDVDLPTHLGLHHHGEEAERAGYSLQELFHLTRSQVSQQRALALQV
LSQIVGRAQAG

RPAP1_C

RPAP1_C
PFAM accession number:PF08620
Interpro abstract (IPR013929):

Inhibition of RNA polymerase II-associated protein 1 (RPAP1) synthesis in Saccharomyces cerevisiae (Baker's yeast) results in changes in global gene expression that are similar to those caused by the loss of the RNAPII subunit Rpb11 [ (PUBMED:15282305) ]. This entry represents the C-terminal region that contains the motif GLHHH. This region is conserved from yeast to humans.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RPAP1_C