The domain within your query sequence starts at position 268 and ends at position 381; the E-value for the RPN13_C domain shown below is 7.3e-38.
QSILATMNVPAGPGGSQQVDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTADEI QNTLTSPQFQQALGMFSAALASGQLGPLMCQFGLPAEAVEAANKGDVEAFAKAM
RPN13_C |
---|
PFAM accession number: | PF16550 |
---|---|
Interpro abstract (IPR032368): | This entry represents an all-helical domain that forms the binding-surface for the proteasome-ubiquitn-receptor protein Rpn13 to UCH37, one of the three de-ubiquitinating enzymes of the proteasome [ (PUBMED:16906146) (PUBMED:20471946) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RPN13_C