The domain within your query sequence starts at position 99 and ends at position 261; the E-value for the RRF domain shown below is 3.1e-43.
LKDNFNKTLNIRTAPGSLDHITVVTADGKVALNQIGQISMKSPQVILVNMASFPECTAAA IKAIRESGMNLNPEVEGTLIRVPIPKVTREHREMLVKLAKQNTNKAKENLRKVRTNAMNK LKKSKDKTSEDTIRLIEKQISQMADDTVAELDQHLAAKTKELL
RRF |
---|
PFAM accession number: | PF01765 |
---|---|
Interpro abstract (IPR023584): | The ribosome recycling factor or ribosome release factor (RRF) dissociates ribosomes from mRNA after termination of translation, and is essential for bacterial growth [ (PUBMED:8183897) ]. Thus ribosomes are 'recycled' and ready for another round of protein synthesis. This entry represents a domain found in ribosome recycling factors. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RRF