SMART: Pfam domain RRF

The domain within your query sequence starts at position 99 and ends at position 261; the E-value for the RRF domain shown below is 3.1e-43.

LKDNFNKTLNIRTAPGSLDHITVVTADGKVALNQIGQISMKSPQVILVNMASFPECTAAA
IKAIRESGMNLNPEVEGTLIRVPIPKVTREHREMLVKLAKQNTNKAKENLRKVRTNAMNK
LKKSKDKTSEDTIRLIEKQISQMADDTVAELDQHLAAKTKELL

RRF

PFAM accession number:	PF01765
Interpro abstract (IPR023584):	The ribosome recycling factor or ribosome release factor (RRF) dissociates ribosomes from mRNA after termination of translation, and is essential for bacterial growth [ (PUBMED:8183897) ]. Thus ribosomes are 'recycled' and ready for another round of protein synthesis. This entry represents a domain found in ribosome recycling factors.

PFAM accession number:

PF01765

Interpro abstract (IPR023584):

The ribosome recycling factor or ribosome release factor (RRF) dissociates ribosomes from mRNA after termination of translation, and is essential for bacterial growth [ (PUBMED:8183897) ]. Thus ribosomes are 'recycled' and ready for another round of protein synthesis.

This entry represents a domain found in ribosome recycling factors.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RRF