The domain within your query sequence starts at position 230 and ends at position 333; the E-value for the RRM_3 domain shown below is 2.2e-32.
GCLLKFSGDLDDQTCREDLHFLFSNHGEIKWVDFARGAKEGIILFKEKAKEALEKARNAN NGNLLLRNKKVTWKVLEGHAEKEALKKITDDQQESLNKWKSKGG
RRM_3 |
---|
PFAM accession number: | PF08777 |
---|---|
Interpro abstract (IPR014886): | This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation. It contains a five stranded beta sheet which forms an atypical RNA recognition motif [ (PUBMED:12842046) ]. |
GO function: | RNA binding (GO:0003723) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RRM_3