The domain within your query sequence starts at position 1 and ends at position 51; the E-value for the RRP7 domain shown below is 8.9e-22.

XRKRARKELLNFYAWQHRETKMEHLAQLRKKFEEDKQRIELMRAQRKFRPY

RRP7

RRP7
PFAM accession number:PF12923
Interpro abstract (IPR024326):

Ribosomal RNA-processing protein 7 (RRP7) is an essential protein in yeast that is involved in pre-rRNA processing and ribosome assembly [ (PUBMED:9271380) ]. It is speculated to be required for correct assembly of rpS27 into the pre-ribosomal particle [ (PUBMED:9271380) (PUBMED:17515605) ].

This entry represents the C-terminal domain of RRP7.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RRP7