The domain within your query sequence starts at position 31 and ends at position 193; the E-value for the RRS1 domain shown below is 3.5e-62.
ELEFDLGNLLASDRNPPTVLRQAGPSPEAELRALARDNTQLLINQLWRLPTERVEEAVVA RLPEPATRLPREKPLPRPRPLTRWQQFARLKGIRPKKKTNLVWDEASGQWRRRWGYKRAR DDTKEWLIEVPGSADPMEDQFAKRTQAKKERVAKNELNRLRNL
RRS1 |
![]() |
---|
PFAM accession number: | PF04939 |
---|---|
Interpro abstract (IPR007023): | This is a family of eukaryotic ribosomal biogenesis regulatory proteins. |
GO process: | ribosome biogenesis (GO:0042254) |
GO component: | nucleus (GO:0005634) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RRS1