SMART: Pfam domain RTP1

The domain within your query sequence starts at position 824 and ends at position 935; the E-value for the RTP1_C1 domain shown below is 1.6e-35.

FREVLLSACDPEVPTRAAALRTLARWVEQREARALEEQKKLLQIFLENLEHEDSFVYLSA
IQGIALLSDVYPEEILVDLLAKYDSGKDKHTPETRMKVGEVLMRVVRALGDM

RTP1_C1

PFAM accession number:	PF10363
Interpro abstract (IPR019451):	This domain is found towards the C-terminal of required for the nuclear transport of RNA pol II protein (Rtp1). Rtp1 is required for the nuclear localisation of RNA polymerase II [ (PUBMED:23438601) ]. This domain is also found in transport and Golgi organisation protein 6 (Tango6) [ (PUBMED:16452979) ].

PFAM accession number:

PF10363

Interpro abstract (IPR019451):

This domain is found towards the C-terminal of required for the nuclear transport of RNA pol II protein (Rtp1). Rtp1 is required for the nuclear localisation of RNA polymerase II [ (PUBMED:23438601) ].

This domain is also found in transport and Golgi organisation protein 6 (Tango6) [ (PUBMED:16452979) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RTP1_C1