The domain within your query sequence starts at position 1026 and ends at position 1059; the E-value for the RTP1_C2 domain shown below is 7.5e-14.

VLRDLYHLLKHVVRLEPDDVAKLHAQLALEELDE

RTP1_C2

RTP1_C2
PFAM accession number:PF10304
Interpro abstract (IPR019414):

This domain is found towards the C terminus of required for the nuclear transport of RNA pol II protein (Rtp1). Rtp1 is required for the nuclear localisation of RNA polymerase II [ (PUBMED:23438601) ]. This domain is found in association with IPR019451 .

This domain is also found in transport and Golgi organisation protein 6 (Tango6) [ (PUBMED:16452979) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RTP1_C2