The domain within your query sequence starts at position 612 and ends at position 769; the E-value for the Rab3-GTPase_cat domain shown below is 2.9e-67.

ANLKPEGRLHQHGKLTLLHNGEPLYIPVTQEPAPMTEDLLEEQSEVLAKLGTSAEGAHLR
ARMQSACLLSDMESFKAANPGCFLEDFVRWYSPRDYIEEEVTDEKGNVVLKGELSARMKI
PSNMWVEAWETAKPVPARRQRRLFDDTREAEKVLHYLA

Rab3-GTPase_cat

 Rab3-GTPase_cat
PFAM accession number:PF13890
Interpro abstract (IPR026147):

Small G proteins of the Rab family are regulators of intracellular vesicle traffic. Their rate of GTP hydrolysis is enhanced by specific GTPase-activating proteins (GAPs) that switch G proteins to their inactive form [ (PUBMED:10859313) ]. This entry represents the Rab3 GTPase-activating protein catalytic subunit. It may participate in neurodevelopmental processes such as proliferation, migration and differentiation before synapse formation, and non-synaptic vesicular release of neurotransmitters [ (PUBMED:9030515) (PUBMED:9852129) ].

GO function:GTPase activator activity (GO:0005096)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rab3-GTPase_cat