SMART: Pfam domain Rad21

The domain within your query sequence starts at position 536 and ends at position 590; the E-value for the Rad21_Rec8 domain shown below is 9.2e-23.

ANKELDFSSLVPPLSPRKLASRVFYLLLVLSTQKILLVEQQKPYGPLLIRPGPKF

Rad21_Rec8

PFAM accession number:	PF04824
Interpro abstract (IPR006909):	This domain represents a conserved C-terminal region found in eukaryotic cohesins of the Rad21, Rec8 and Scc1 families. Rad21/Rec8 like proteins mediate sister chromatid cohesion during mitosis and meiosis, as part of the cohesin complex [ (PUBMED:11687503) ]. Cohesion is necessary for homologous recombination (including double-strand break repair) and correct chromatid segregation. These proteins may also be involved in chromosome condensation. Dissociation at the metaphase to anaphase transition causes loss of cohesion and chromatid segregation [ (PUBMED:10207075) ].

PFAM accession number:

PF04824

Interpro abstract (IPR006909):

This domain represents a conserved C-terminal region found in eukaryotic cohesins of the Rad21, Rec8 and Scc1 families. Rad21/Rec8 like proteins mediate sister chromatid cohesion during mitosis and meiosis, as part of the cohesin complex [ (PUBMED:11687503) ]. Cohesion is necessary for homologous recombination (including double-strand break repair) and correct chromatid segregation. These proteins may also be involved in chromosome condensation. Dissociation at the metaphase to anaphase transition causes loss of cohesion and chromatid segregation [ (PUBMED:10207075) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rad21_Rec8