The domain within your query sequence starts at position 1 and ends at position 111; the E-value for the Rad21_Rec8_N domain shown below is 3.9e-43.
MFYTHVLMSKRGPLAKIWLAAHWEKKLTKAHVFECNLEITIQKIISPKVKIALRTSGHLL LGVVRIYNRKAKYLLADCSEAFLKMKMTFRPGLVDLPKENFEAAYNTITLP
Rad21_Rec8_N |
---|
PFAM accession number: | PF04825 |
---|---|
Interpro abstract (IPR006910): | This domain represents a conserved N-terminal region found in eukaryotic cohesins of the Rad21, Rec8 and Scc1 families. Rad21/Rec8 like proteins mediate sister chromatid cohesion during mitosis and meiosis, as part of the cohesin complex [ (PUBMED:11687503) ]. Cohesion is necessary for homologous recombination (including double-strand break repair) and correct chromatid segregation. These proteins may also be involved in chromosome condensation. Dissociation at the metaphase to anaphase transition causes loss of cohesion and chromatid segregation [ (PUBMED:10207075) ]. |
GO function: | protein binding (GO:0005515) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rad21_Rec8_N