The domain within your query sequence starts at position 659 and ends at position 712; the E-value for the Rad50_zn_hook domain shown below is 9.9e-16.
LAGATAVYSQFITQLTDENQSCCPVCQRVFQTEAELQEVISDLQSKLRLAPDKL
Rad50_zn_hook |
---|
PFAM accession number: | PF04423 |
---|---|
Interpro abstract (IPR013134): | The MRN complex (Mre11-Rad50-Nbs1) plays an important role in many DNA metabolic events that involve DNA double-stranded breaks. MRN is one of the first factors to be localised to DNA lesions where it might have a structural role by tethering and stabilising broken chromosomes [ (PUBMED:12949583) (PUBMED:11741547) ]. Rad50 is a split ABC-type ATPase; its centre contains a long heptad repeat that folds into an antiparallel coiled coil, bringing the N-terminal (Walker A) and the C-terminal (Walker B) domains in close proximity [ (PUBMED:12152085) ]. The apex of the coiled coil contains a dimerization interface, a conserved Cys-X-X-Cys motif in a hook-shaped domain that dimerizes with a second hook domain via cysteine-mediated zinc ion coordination. This zinc dependent dimerization event allows the formation of a complex that has appropriate lengths and conformational proporties to link sister chromatids in homologous recombination and DNA ends in non-homologous end-joining. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rad50_zn_hook