The domain within your query sequence starts at position 36 and ends at position 184; the E-value for the Rad52_Rad22 domain shown below is 6.6e-51.
EYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVD FVDLNNGKFYVGVCAFVKVQLKDGSYHEDVGYGVSEGLRSKALSLEKARKEAVTDGLKRA LRSFGNALGNCILDKDYLRSLNKLPRQLP
Rad52_Rad22 |
---|
PFAM accession number: | PF04098 |
---|---|
Interpro abstract (IPR041247): | The DNA single-strand annealing proteins (SSAPs), such as RecT, Red-beta, ERF and Rad52, function in RecA-dependent and RecA-independent DNA recombination pathways. This family includes proteins related to Rad52. These proteins contain two helix-hairpin-helix motifs [ (PUBMED:11914131) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rad52_Rad22