The domain within your query sequence starts at position 74 and ends at position 199; the E-value for the Radical_SAM domain shown below is 2.5e-22.
ISLTEKCNLRCQYCMPEEGVPLTPKADLLTTEEILTLARLFVKEGVDKIRLTGGEPLIRP DVVDIVARLHGLEGLRTIGLTTNGINLARLLPRLQQAGLNAVNISLDTLVPAKFEFIVRR KGDRRL
Radical_SAM |
![]() |
---|
PFAM accession number: | PF04055 |
---|---|
Interpro abstract (IPR007197): | Radical SAM proteins catalyze diverse reactions, including unusual methylations, isomerization, sulphur insertion, ring formation, anaerobic oxidation and protein radical formation. Evidence exists that these proteins generate a radical species by reductive cleavage of S:-adenosylmethionine (SAM) through an unusual Fe-S centre [ (PUBMED:11222759) (PUBMED:15317939) ]. |
GO function: | catalytic activity (GO:0003824), iron-sulfur cluster binding (GO:0051536) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Radical_SAM