The domain within your query sequence starts at position 315 and ends at position 392; the E-value for the Rap1_C domain shown below is 2e-13.
LMEKFNLDLSTVTQALLKNSGELEATSSFLESGRRPDGYPIWCRQDDLDLQKDDDDTKNA LVKKFGAQNVARRIEFRK
Rap1_C |
---|
PFAM accession number: | PF11626 |
---|---|
Interpro abstract (IPR021661): | This family of proteins represents the C-terminal domain of the protein Rap-1, which plays a distinct role in silencing at the silent mating-type loci and telomeres [ (PUBMED:18538788) ]. The Rap-1 C terminus adopts an all-helical fold. Rap1 carries out its function by recruiting the Sir3 and Sir4 proteins to chromatin via its C-terminal domain [ (PUBMED:18538788) ]. Rap1 is otherwise known as TRF2-interacting protein, as it is one of the six subunit components of the Shelterin complex. Shelterin protects telomere ends from attack by DNA-repair mechanisms [ (PUBMED:15316005) (PUBMED:16166375) (PUBMED:20339076) (PUBMED:20622869) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rap1_C