The domain within your query sequence starts at position 457 and ends at position 498; the E-value for the Rbsn domain shown below is 9e-21.

PLLQQIYNITSFIRQAKAAGRTDEVRTLQENLRQLQDEYDQQ

Rbsn

 Rbsn
PFAM accession number:PF11464
Interpro abstract (IPR021565):

Rabenosyn-5 (Rbsn) is a multivalent effector with interacts with the Rab family. Rsbn contains distinct Rab4 and Rab5 binding sites within residues 264-500 and 627-784 respectively [ (PUBMED:16034420) ]. Rab proteins are GTPases involved in the regulation of all stages of membrane trafficking [ (PUBMED:16034420) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rbsn