SMART: Pfam domain RecQ5

The domain within your query sequence starts at position 626 and ends at position 818; the E-value for the RecQ5 domain shown below is 3.1e-97.

KSCGAAAEFSEPSDYDIPPTSHVYSLKPKRVGAGFSKGPCSFQTATELLGKSHSQKQAPE
AMLEGGQEPPGWVCDLQDEDRSKPHPGYQEKALGSSVNCGDPSPEKKTKGSSQGSAKARA
SKKQQLLATAARKDSQNITRFLCQRTESPPLPASVPRSEDASPSCGDVPGKCTQEVGAQG
HLVAVFQTEGPRE

RecQ5

PFAM accession number:	PF06959
Interpro abstract (IPR010716):	This entry represents a domain found in RECQ5. RecQ helicases is a group of highly conserved 3'-5' DNA helicases involved in maintaining genomic stability. RECQ5 plays an important role in DNA replication, transcription and repair [ (PUBMED:20643585) (PUBMED:20348101) ]. It interacts with RNA polymerase II to reduce transcription-associated replication impairment and recombination [ (PUBMED:20231364) ]. As a helicase, it can disrupt RAD51 filaments assembled on ssDNA, thereby inhibiting homologous recombination [ (PUBMED:23748380) ]. It also participates in psoralen-induced interstrand cross-link repair [ (PUBMED:23715498) ]. It stimulates DNA decatenation mediated by TOP2A [ (PUBMED:22013166) ].

PFAM accession number:

PF06959

Interpro abstract (IPR010716):

This entry represents a domain found in RECQ5. RecQ helicases is a group of highly conserved 3'-5' DNA helicases involved in maintaining genomic stability. RECQ5 plays an important role in DNA replication, transcription and repair [ (PUBMED:20643585) (PUBMED:20348101) ]. It interacts with RNA polymerase II to reduce transcription-associated replication impairment and recombination [ (PUBMED:20231364) ]. As a helicase, it can disrupt RAD51 filaments assembled on ssDNA, thereby inhibiting homologous recombination [ (PUBMED:23748380) ]. It also participates in psoralen-induced interstrand cross-link repair [ (PUBMED:23715498) ]. It stimulates DNA decatenation mediated by TOP2A [ (PUBMED:22013166) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RecQ5