The domain within your query sequence starts at position 835 and ends at position 905; the E-value for the RecQ_Zn_bind domain shown below is 2.2e-8.
PADFNTSRNLLIEIHDEKFRLYKLKMMVKMEKYLHSSQCRRRIILSHFEDKCLQKASLDI MGTEKCCDNCR
RecQ_Zn_bind |
![]() |
---|
PFAM accession number: | PF16124 |
---|---|
Interpro abstract (IPR032284): | This domain is the zinc-binding domain of ATP-dependent DNA helicase RecQ [ (PUBMED:14517231) (PUBMED:19151156) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RecQ_Zn_bind