The domain within your query sequence starts at position 7 and ends at position 157; the E-value for the Redoxin domain shown below is 3.9e-20.
QIGKSAPDFTATAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFR KLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAY RGLFIIDAKGVLRQITVNDLPVGRSVDEALR
Redoxin |
---|
PFAM accession number: | PF08534 |
---|---|
Interpro abstract (IPR013740): | This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins. Peroxiredoxins (Prxs) constitute a family of thiol peroxidases that reduce hydrogen peroxide, peroxinitrite, and hydroperoxides using a strictly conserved cysteine [ (PUBMED:15697201) (PUBMED:27624005) ]. Chloroplast thioredoxin systems in plants regulate the enzymes involved in photosynthetic carbon assimilation [ (PUBMED:18047840) ]. It is thought that redoxins have a large role to play in anti-oxidant defence. Cadmium-sensitive proteins are also regulated via thioredoxin and glutaredoxin thiol redox systems [ (PUBMED:17103236) ]. |
GO function: | oxidoreductase activity (GO:0016491) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Redoxin