The domain within your query sequence starts at position 1 and ends at position 84; the E-value for the RelB_leu_zip domain shown below is 1.2e-43.
MPSRRAARESAPELGALGSSDLSSLSLTVSRTTDELEIIDEYIKENGFGLDGTQLSEMPR LVPRGPASLSSVTLGPAAPPPPAT
RelB_leu_zip |
 |
|---|
| PFAM accession number: | PF16180 |
|---|---|
| Interpro abstract (IPR032399): | This domain is a leucine zipper found in RelB transcription factors [ (PUBMED:17869269) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RelB_leu_zip