The domain within your query sequence starts at position 5 and ends at position 113; the E-value for the Rep_fac-A_3 domain shown below is 2.5e-36.
MQLPKARVNASMLPQYIDRPVCFVGKLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEIS GIVEVVGKVTAKATVLCASYTLFKEDTNRFDLELYNEAVKIINELPQFF
Rep_fac-A_3 |
---|
PFAM accession number: | PF08661 |
---|---|
Interpro abstract (IPR013970): | Rfa3 (also known as RPA14) is a component of the replication protein A (RPA) complex, which binds to and removes secondary structure from ssDNA. The RPA complex is involved in DNA replication, repair, and recombination [ (PUBMED:20012581) ]. |
GO process: | DNA repair (GO:0006281), DNA recombination (GO:0006310), DNA replication (GO:0006260) |
GO component: | nucleus (GO:0005634) |
GO function: | DNA binding (GO:0003677) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rep_fac-A_3