SMART: Pfam domain Rep_fac-A

The domain within your query sequence starts at position 470 and ends at position 615; the E-value for the Rep_fac-A_C domain shown below is 9.2e-56.

YFSTVAAVVFLRKENCMYQACPTQDCNKKVIDQQNGLYRCEKCDREFPNFKYRMILSANI
ADFQENQWVTCFQESAEAILGQNTMYLGELKEKNEQAFEEVFQNANFRSFTFRIRVKLET
YNDESRIKATVMDVKPVDFRDYGRRL

Rep_fac-A_C

PFAM accession number:	PF08646
Interpro abstract (IPR013955):	Replication factor A (RP-A) binds and subsequently stabilises single-stranded DNA intermediates and thus prevents complementary DNA from reannealing. It also plays an essential role in several cellular processes in DNA metabolism including replication, recombination and repair of DNA [ (PUBMED:10713540) ]. Replication factor-A protein is also known as Replication protein A 70kDa DNA-binding subunit. This entry is found at the C terminus of Replication factor A.

PFAM accession number:

PF08646

Interpro abstract (IPR013955):

Replication factor A (RP-A) binds and subsequently stabilises single-stranded DNA intermediates and thus prevents complementary DNA from reannealing. It also plays an essential role in several cellular processes in DNA metabolism including replication, recombination and repair of DNA [ (PUBMED:10713540) ]. Replication factor-A protein is also known as Replication protein A 70kDa DNA-binding subunit.

This entry is found at the C terminus of Replication factor A.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rep_fac-A_C