The domain within your query sequence starts at position 10 and ends at position 279; the E-value for the Rft-1 domain shown below is 4.1e-36.
AARLASSGLLLQVLFRLITFVLNAFILRFLSKEIVGIVNVRLTLLYSTTTFLAREAFRRA CLSGGAQRDWSQTLNLLWLTVPLGIFWSSCLGWVWLQLLEVPDPDVVPYYGTGVLFFGLS AVVELLGEPFWVLAQAHMFVKLKVLAESMSVILRSVLTALLVLWLPHWGLYIFSLAQLLY TTVLVLCYAIYLIQLLRSPESAKQLTLPVSRVTQLLPSISRSRAFVNWKEAGLAWSFFKQ SFLKQILTEGERYVMTFLNVLNFGDQGKMC
Rft-1 |
---|
PFAM accession number: | PF04506 |
---|---|
Interpro abstract (IPR007594): | Asymmetric lipid distribution is a fundamental characteristic of biological lipid bilayers, one such axample is the translocation of the Man 5 GlcNAc 2 -PP-Dol intermediate from the cytosolic side of the ER membrane to the lumen before the completion of the biosynthesis of Glc 3 Man 9 GlcNAc 2 -PP-Dol [ (PUBMED:11807558) ]. RFT1 encodes an evolutionarily conserved protein required for this translocation. |
GO process: | dolichol-linked oligosaccharide biosynthetic process (GO:0006488) |
GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rft-1