The domain within your query sequence starts at position 84 and ends at position 165; the E-value for the Rgp1 domain shown below is 2.9e-24.
RGERGQCILSTPPKILFCDLRLDPGESKSYSYSEVLPTEGPPSFRGQSVKYVYKLTIGCQ RVNSPITLLRVPLRVLVLTGLQ
Rgp1 |
---|
PFAM accession number: | PF08737 |
---|---|
Interpro abstract (IPR014848): | Rgp1 forms heterodimer with Ric1 ( IPR009771 ) which associates with Golgi membranes and functions as a guanyl-nucleotide exchange factor [ (PUBMED:10990452) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rgp1