The domain within your query sequence starts at position 396 and ends at position 459; the E-value for the Rhodanese_C domain shown below is 2.4e-21.
KGKLFVFDERFALAYNSSVVSECSYCGAPWDQYKLCSTPQCRQLVLTCSACQGQGFTACC VTCQ
Rhodanese_C |
---|
PFAM accession number: | PF12368 |
---|---|
Interpro abstract (IPR022111): | This domain is found as the domain-extension to Rhodanase enzyme in some members of the Rhodanase family. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rhodanese_C