The domain within your query sequence starts at position 91 and ends at position 308; the E-value for the Rhomboid_SP domain shown below is 1.6e-116.
VSKDSDSTQKWQRKSIRHCSQRYGKLKPQVIRELDLPSQDNVSLTSTETPPPLYVGPCQL GMQKIIDPLARGRAFRMADDTADGLSAPHTPVTPGAASLCSFSSSRSGFNRLPRRRKRES VAKMSFRAAAALVKGRSIRDGTLRRGQRRSFTPASFLEEDMVDFPDELDTSFFAREGVLH EEMSTYPDEVFESPSEAALKDWEKAPDQADLTGGALDR
Rhomboid_SP |
![]() |
---|
PFAM accession number: | PF12595 |
---|---|
Interpro abstract (IPR022241): | This domain family is found in eukaryotes, and is approximately 210 amino acids in length. The family is found in association with . Rhomboid is a seven-transmembrane spanning protein that resides in the Golgi and acts as a serine protease to cleave Spitz. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rhomboid_SP