The domain within your query sequence starts at position 11 and ends at position 129; the E-value for the Ribonuc_L-PSP domain shown below is 1.7e-46.
TTKAPAAIGPYSQAVQVDRTIYISGQVGLDPSSGQLVPGGVVEEAKQALKNLGEILKAAG CDFNNVVKTTVLLADMNDFGTVNEIYKTYFQGSLPARAAYQVAALPRGSRVEIEAIAVQ
Ribonuc_L-PSP |
---|
PFAM accession number: | PF01042 |
---|---|
Interpro abstract (IPR006175): | The YjgF/YER057c/UK114 family (also known as the Rid family) of proteins is conserved in all domains of life [ (PUBMED:22094463) ]. A phylogenetic analysis applied by Lambrecht et al. has divided the Rid family into a widely distributed archetypal RidA (YjgF) subfamily and seven other subfamilies (Rid1 to Rid7) that are largely confined to bacteria and often co-occur in the same organism with RidA and each other [ (PUBMED:25975565) ]. Although the family members share high levels of protein sequence and structue similarity, their functions vary widely across different species [ (PUBMED:4632080) ]. Structurally, these proteins are homotrimers with clefts between the monomeric subunits that are proposed to have some functional relevance [ (PUBMED:19899170) (PUBMED:12112709) (PUBMED:10595546) ]. This family includes:
|
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ribonuc_L-PSP