The domain within your query sequence starts at position 11 and ends at position 129; the E-value for the Ribonuc_L-PSP domain shown below is 1.7e-46.

TTKAPAAIGPYSQAVQVDRTIYISGQVGLDPSSGQLVPGGVVEEAKQALKNLGEILKAAG
CDFNNVVKTTVLLADMNDFGTVNEIYKTYFQGSLPARAAYQVAALPRGSRVEIEAIAVQ

Ribonuc_L-PSP

Ribonuc_L-PSP
PFAM accession number:PF01042
Interpro abstract (IPR006175):

The YjgF/YER057c/UK114 family (also known as the Rid family) of proteins is conserved in all domains of life [ (PUBMED:22094463) ]. A phylogenetic analysis applied by Lambrecht et al. has divided the Rid family into a widely distributed archetypal RidA (YjgF) subfamily and seven other subfamilies (Rid1 to Rid7) that are largely confined to bacteria and often co-occur in the same organism with RidA and each other [ (PUBMED:25975565) ]. Although the family members share high levels of protein sequence and structue similarity, their functions vary widely across different species [ (PUBMED:4632080) ].

Structurally, these proteins are homotrimers with clefts between the monomeric subunits that are proposed to have some functional relevance [ (PUBMED:19899170) (PUBMED:12112709) (PUBMED:10595546) ].

This family includes:

  • YjgF (also known as RidA or 2-iminobutanoate/2-iminopropanoate deaminase), which displays enamine/imine deaminase activity and can accelerate the release of ammonia from reactive enamine/imine intermediates of the pyridoxal 5'-phosphate-dependent threonine dehydratase (IlvA) [ (PUBMED:22094463) (PUBMED:18296521) ]
  • the yeast growth inhibitor YER057c (protein HMF1) that appears to play a role in the regulation of metabolic pathways and cell differentiation [ (PUBMED:11442631) ]
  • the mammalian 14.5kDa translational inhibitor protein UK114, also known as L-PSP (liver perchloric acid-soluble protein), with endoribonucleolytic activity that directly affects mRNA translation and can induce disaggregation of the reticulocyte polysomes into 80 S ribosomes [ (PUBMED:10400702) ]
  • RutC from E. coli, which is essential for growth on uracil as sole nitrogen source and is thought to reduce aminoacrylate peracid to aminoacrylate [ (PUBMED:20400551) ]
  • YabJ from B. subtilis, which is required for adenine-mediated repression of purine biosynthetic genes [ (PUBMED:10557275) ]

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ribonuc_L-PSP