The domain within your query sequence starts at position 19 and ends at position 67; the E-value for the Ribonuc_P_40 domain shown below is 1.5e-19.

LHYFDEPKLAPWVTLTVQGFADSPVAWREKEHGFHKGGEHLYNFVVFNN

Ribonuc_P_40

• PFAM accession number: PF08584
• Interpro abstract (IPR013893):

  The tRNA processing enzyme ribonuclease P (RNase P) consists of an RNA molecule and at least eight protein subunits. Subunits hpop1, Rpp21, Rpp29, Rpp30, Rpp38, and Rpp40 (this entry) are involved in extensive, but weak, protein-protein interactions in the holoenzyme complex [ (PUBMED:11158571) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ribonuc_P_40