The domain within your query sequence starts at position 85 and ends at position 324; the E-value for the Ribonuc_P_40 domain shown below is 1.7e-83.
TFVKKGKLILSLDKDTYEETGLQGRPSRYSGRKSMKFVISIDLMDLSLNLDSKKYRRISW SFKEKKPLKFDFLLAWHPTGTEESTMMSYFSKYQIQEHQPKVALSTVRELQCPVLRSSGL AGEPEEACSALEFFDWLGAVFCSADLNNEPYNFISTYCCPQPSAVVAQAFLCTITGFILP EKIHVLLEQLCHYFDEPKLAPWVTLTVQGFADSPVAWREKEHGFHKGGEHLYNFVVFNNQ
Ribonuc_P_40 |
---|
PFAM accession number: | PF08584 |
---|---|
Interpro abstract (IPR013893): | The tRNA processing enzyme ribonuclease P (RNase P) consists of an RNA molecule and at least eight protein subunits. Subunits hpop1, Rpp21, Rpp29, Rpp30, Rpp38, and Rpp40 (this entry) are involved in extensive, but weak, protein-protein interactions in the holoenzyme complex [ (PUBMED:11158571) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ribonuc_P_40