The domain within your query sequence starts at position 61 and ends at position 156; the E-value for the Ribosomal_L50 domain shown below is 1.3e-15.

YTPPSDLQSRLESHIKEVLGSSLPNNWQDISLDDGHMKFRLLAGLADGLGHAVPNSRLHQ
MCRVRDVLDFYNVPVQDKSKFDELVASNLPPNLKIS

Ribosomal_L50

Ribosomal_L50
PFAM accession number:PF10501
Interpro abstract (IPR018305):

This entry represents the L50 protein from the mitochondrial 39S ribosomal subunit. L50 appears to be a secondary RNA-binding protein [ (PUBMED:3129699) ]. The 39S ribosomal protein appears to be a subunit of one of the larger mitochondrial 66S or 70S units [ (PUBMED:8947311) ]. Under conditions of ethanol-stress in rats the larger subunit is largely dissociated into its smaller components [ (PUBMED:15928344) ].

GO component:mitochondrion (GO:0005739)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ribosomal_L50