The domain within your query sequence starts at position 5 and ends at position 73; the E-value for the Ribosomal_S17_N domain shown below is 1.9e-40.
QTERAYQKQPTIFQNKKRVLLGETGKEKLPRYYKNIGLGFKTPKEAIEGTYIDKKCPFTG NVSIRGRIL
Ribosomal_S17_N |
 |
|---|
| PFAM accession number: | PF16205 |
|---|---|
| Interpro abstract (IPR032440): | This short N-terminal region is found in a number of eukaryotic ribosomal subunit 11 proteins [ (PUBMED:8093055) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ribosomal_S17_N