The domain within your query sequence starts at position 1 and ends at position 259; the E-value for the Ribosomal_S8e domain shown below is 1.3e-49.
MPQNEYIELHRKRYGYRLDYHEKKRKKEGREAHERSKKAKKMIGLKAKLYHKQRHAEKIQ MKKTIKMHEKRNTKQKDDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP LPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGK YAQVTNNPENDGCINAVLL
Ribosomal_S8e |
---|
PFAM accession number: | PF01201 |
---|---|
Interpro abstract (IPR022309): | A number of eukaryotic and archaeal ribosomal proteins have been grouped based on sequence similarities [ (PUBMED:7662106) ]. One of these families, S8e, consists of a number of proteins with either about 220 amino acids (in eukaryotes) or about 125 amino acids (in archaea). This entry also contains proteins annotated as NSA2, which are though to be involved in ribosomal biogenesis of the 60S ribosomal subunit, having a role in the quality control of pre-60S particles. They are a component of the pre-66S ribosomal particle. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ribosomal_S8e