The domain within your query sequence starts at position 59 and ends at position 150; the E-value for the Ripply domain shown below is 3.1e-36.

LWRPWLSSINDQPRQARSLVDWADNRATAAEAAKTDSDFHHPVRLYWPKSHSFDYLYSAG
EILLNNFPVQATINLYEDSDSADNEEDKEEEE

Ripply

Ripply
PFAM accession number:PF14998
Interpro abstract (IPR028127):

The precise function of this family is not clear, but it is thought to play a role in somitogenesis, development and transcriptional repression [ (PUBMED:19247927) ]. This family contains two conserved sequence motifs: WRPW and FPVQATI. The WRPW motif is thought to be required for binding to tle/groucho proteins [ (PUBMED:16586348) ]. Ripply2.2 is also known as Bowline and is an associate protein of the transcriptional co-repressor XGrg-4 [ (PUBMED:17577580) ]. Ripply3 is also known as Down Syndrome Critical Region Protein 6 homologue [ (PUBMED:10814524) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ripply