The domain within your query sequence starts at position 13 and ends at position 79; the E-value for the Romo1 domain shown below is 2e-30.
PSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTFMA IGMGIRC
Romo1 |
![]() |
---|
PFAM accession number: | PF10247 |
---|---|
Interpro abstract (IPR018450): | This entry includes a group of mitochondrial proteins, including reactive oxygen species modulator 1 (Romo1) from animals and Mgr2 from fungi. Budding yeast Mgr2 is a subunit of the TIM23 translocase complex, which translocates preproteins into and across the membrane and associates with the matrix-localized import motor. It is required for binding of Tim21 to TIM23(CORE). Mrg2 is essential for cell growth at elevated temperature and for efficient protein import [ (PUBMED:22613836) ]. Romo1 is responsible for increasing the level of ROS in cells. In various cancer cell lines with elevated levels of ROS there is also an increased abundance of Romo1 [ (PUBMED:16842742) ]. Increased Romo1 expression can have a number of other affects including: inducing premature senescence of cultured human fibroblasts [ (PUBMED:18836179) (PUBMED:18313394) ] and increased resistance to 5-fluorouracil [ (PUBMED:17537404) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Romo1