The domain within your query sequence starts at position 1 and ends at position 48; the E-value for the Rpr2 domain shown below is 4.4e-12.
RQDPSVKRTLCRSCSSLLIPGLTCTQRQRRECCPRDICEAERDSAGQY
Rpr2 |
---|
PFAM accession number: | PF04032 |
---|---|
Interpro abstract (IPR007175): | This family contains a ribonuclease P subunit of human and yeast. Nnuclear RNase P cleaves tRNA precursors to generate mature 5' ends and facilitates turnover of nuclear RNAs [ (PUBMED:11880623) ]. Other members of the family include the probable archaeal homologues. This subunit possibly binds the precursor tRNA [ (PUBMED:11497433) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rpr2