The domain within your query sequence starts at position 92 and ends at position 215; the E-value for the Rrp15p domain shown below is 3e-32.
WADAMAKILNKKTPKSKATILTKNKELEKEKEKLKQERLEKRKQLDKKREWEMLCRVKPD VVKDKEAERNLQRIATRGVVQLFNAVQKHQRNVGEKVKEAGGSVRKRAKLMSTVSKKDFI SVLR
Rrp15p |
---|
PFAM accession number: | PF07890 |
---|---|
Interpro abstract (IPR012459): | Rrp15 is a constituent of pre-60S ribosomal particles. It is required for large subunit rRNA maturation, in particular processing of the 27S pre-rRNA at the A3 and B1 sites to yield 5.8S and 25S rRNA [ (PUBMED:15769876) ]. |
GO process: | rRNA processing (GO:0006364) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rrp15p