SMART: Pfam domain Rtf2

The domain within your query sequence starts at position 1 and ends at position 290; the E-value for the Rtf2 domain shown below is 1.5e-99.

MGCDGGTIPKRHELVKGPKKVEKVDKDAELVAQWNYCTLSQEILRRPIVACELGRLYNKD
AVIEFLLDKSAEKALGKAASHIRSIKNVTELRLSDNPAWEGDKGNTKGDKHDDLQRARFI
CPVVGLEMNGRHRFCFLRCCGCVFSERALKEIKAEVCHTCGAAFQEEDIIVLNGTKEDVE
MLKKRMEERRLRAKLEKKTKKPKTATECASKPGTTQDSAGPSKVKSGKPEEADPDPREKK
STPAPRGAATNGSASGKVGKPPCGALKRSIADSEESETYKSIFTSHSSAK

Rtf2

PFAM accession number:	PF04641
Interpro abstract (IPR027799):	It is vital for effective cell-replication that replication is not stalled at any point by, for instance, damaged bases. Replication termination factor 2 (Rtf2) stabilises the replication fork stalled at the site-specific replication barrier RTS1 by preventing replication restart until completion of DNA synthesis by a converging replication fork initiated at a flanking origin. The RTS1 element terminates replication forks that are moving in the cen2-distal direction while allowing forks moving in the cen2-proximal direction to pass through the region. Rtf2 contains a C2HC2 motif related to the C3HC4 RING-finger motif, and would appear to fold up, creating a RING finger-like structure but forming only one functional Zn2+ ion-binding site [ (PUBMED:19416828) ]. This domain is also found at the N terminus of peptidyl-prolyl cis-trans isomerase 4, a divergent cyclophilin family [ (PUBMED:9803414) ].

PFAM accession number:

PF04641

Interpro abstract (IPR027799):

It is vital for effective cell-replication that replication is not stalled at any point by, for instance, damaged bases. Replication termination factor 2 (Rtf2) stabilises the replication fork stalled at the site-specific replication barrier RTS1 by preventing replication restart until completion of DNA synthesis by a converging replication fork initiated at a flanking origin. The RTS1 element terminates replication forks that are moving in the cen2-distal direction while allowing forks moving in the cen2-proximal direction to pass through the region. Rtf2 contains a C2HC2 motif related to the C3HC4 RING-finger motif, and would appear to fold up, creating a RING finger-like structure but forming only one functional Zn2+ ion-binding site [ (PUBMED:19416828) ]. This domain is also found at the N terminus of peptidyl-prolyl cis-trans isomerase 4, a divergent cyclophilin family [ (PUBMED:9803414) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rtf2