The domain within your query sequence starts at position 330 and ends at position 465; the E-value for the Rubis-subs-bind domain shown below is 1.3e-16.
TEKLLVCERWDFLCKQEMVGEEGAFVIGCEEVLTEEELATTLKVLCMPAEEFRDYKERAG WGEEETEDDSLAITDIPKLQESWKRLLRNSVLLTLQTYTTDLKTDQDLLSNKEAYATLSW REQQALQVRYGQKMIL
Rubis-subs-bind |
![]() |
---|
PFAM accession number: | PF09273 |
---|---|
Interpro abstract (IPR015353): | This domain adopts a multihelical structure, with an irregular array of long and short alpha-helices. It allows binding of the protein to substrate, such as the N-terminal tails of histones H3 and H4 and the large subunit of the Rubisco holoenzyme complex [ (PUBMED:12819771) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rubis-subs-bind