The domain within your query sequence starts at position 358 and ends at position 451; the E-value for the RunxI domain shown below is 6.4e-43.
PGSSQAQAGPFQTGSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTNASTGAALLNPS LPSQSDVVETEGSHSNSPTNMPPARLEEAVWRPY
RunxI |
---|
PFAM accession number: | PF08504 |
---|---|
Interpro abstract (IPR013711): | This domain lies to the C terminus of Runx-related transcription factors and homologous proteins (AML, CBF-alpha, PEBP2). Its function might be to interact with functional cofactors [ (PUBMED:15713794) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RunxI