The domain within your query sequence starts at position 476 and ends at position 524; the E-value for the SAB domain shown below is 1.1e-29.
MLEDLDKSQEEIKKHHASISELKKNFMESVPEPRPSEWDKRLSTHSPFR
SAB |
![]() |
---|
PFAM accession number: | PF04382 |
---|---|
Interpro abstract (IPR007477): | This presumed domain is found in proteins containing FERM domains IPR000299 . This domain is found to bind to both spectrin and actin, hence the name SAB (Spectrin and Actin Binding) domain. |
GO process: | cortical actin cytoskeleton organization (GO:0030866) |
GO component: | cytoskeleton (GO:0005856) |
GO function: | cytoskeletal protein binding (GO:0008092) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SAB