The domain within your query sequence starts at position 113 and ends at position 165; the E-value for the SAP30_Sin3_bdg domain shown below is 7.5e-28.
LQVNTLRRYKRHYKLQTRPGFNKAQLAETVSRHFRNIPVNEKETLAYFIYMVK
SAP30_Sin3_bdg |
---|
PFAM accession number: | PF13867 |
---|---|
Interpro abstract (IPR025718): | This C-terminal domain of the SAP30 proteins appears to be the binding region for Sin3 [ (PUBMED:9651585) ]. |
GO function: | protein binding (GO:0005515) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SAP30_Sin3_bdg