The domain within your query sequence starts at position 113 and ends at position 165; the E-value for the SAP30_Sin3_bdg domain shown below is 7.5e-28.

LQVNTLRRYKRHYKLQTRPGFNKAQLAETVSRHFRNIPVNEKETLAYFIYMVK

SAP30_Sin3_bdg

SAP30_Sin3_bdg
PFAM accession number:PF13867
Interpro abstract (IPR025718):

This C-terminal domain of the SAP30 proteins appears to be the binding region for Sin3 [ (PUBMED:9651585) ].

GO function:protein binding (GO:0005515)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SAP30_Sin3_bdg