The domain within your query sequence starts at position 100 and ends at position 170; the E-value for the SAYSvFN domain shown below is 8e-33.
KVLLWLVLLGLFVELEFGLAYFVLSMFYWMYVGTRGPEEKKEGEKSAYSVFNPGCEAIQG TLTAEQLEQEL
SAYSvFN |
---|
PFAM accession number: | PF10260 |
---|---|
Interpro abstract (IPR019387): | This domain of approximately 75 residues contains a highly conserved SATSv/iFN motif. The function is unknown but the domain is conserved from plants to humans. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SAYSvFN